TSPAN3 Rabbit Polyclonal Antibody

SKU: orb579835

Description

Rabbit polyclonal antibody to TSPAN3

Research Area

Signal Transduction

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TSPAN3
• Target: TSPAN3
• Protein Sequence: Synthetic peptide located within the following region: SRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASNCNG
• Molecular Weight: 25kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

TM4-A, TM4SF8, TSPAN-3

Rabbit Anti-TSPAN3 Antibody, Catalog Number: orb579835, Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue, Observed Staining: Plasma membrane in spermatogonia and spermatocytes, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-TSPAN3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Hela cell lysate.

Quick Database Links

Gene Symbol

TSPAN3

UniProt

O60637

RefSeq (Protein):NP_944492