Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

TSG101 Rabbit Polyclonal Antibody

SKU: orb576460

Description

TSG101 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of TSG101. It is suitable for WB application. The immunogen is a synthetic peptide corresponding to a region of Mouse. This antibody reacts with Mouse samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Rat, Yeast. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityMouse
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Rat, Yeast

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
TargetTSG101
Protein SequenceSynthetic peptide located within the following region: YMPGMPSGISAYPSGYPPNPSGYPGCPYPPAGPYPATTSSQYPSQPPVTT
Molecular Weight43kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

CC2, AI255943

Similar Products

  • TSG101 Rabbit Polyclonal Antibody [orb11527]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Mouse, Rabbit

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Tsg 101 rabbit pAb Antibody [orb770328]

    ELISA,  IF,  IHC,  WB

    Human, Monkey, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • TSG101 Antibody (N-term) [orb1931675]

    IHC-P,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • TSG101 Rabbit Polyclonal Antibody [orb576274]

    IHC,  WB

    Bovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Rat

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • TSG101 Rabbit Polyclonal Antibody [orb515563]

    IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

TSG101 Rabbit Polyclonal Antibody

WB Suggested Anti-TSG101 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:62500, Positive Control: NIH/3T3 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_068684

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

TSG101 Rabbit Polyclonal Antibody (orb576460)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 550.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry