You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291813 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant TSC22D1. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | TSC22D1 (AAH00456, 1 a.a. ~ 144 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA |
Tested applications | ELISA, IF, WB |
Clone Number | 1G7 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH00456 |
Detection limit for recombinant GST tagged TSC22D1 is approximately 0.03 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to TSC22D1 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot analysis of TSC22D1 expression in transfected 293T cell line by TSC22D1 monoclonal antibody (M01), clone 1G7. Lane 1: TSC22D1 transfected lysate (15.7 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (41.58 KDa).