TSC22D1 monoclonal antibody (M01), clone 1G7

• Catalog Number: orb2291813
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant TSC22D1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1G7
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG1 kappa
• Immunogen: TSC22D1 (AAH00456, 1 a.a. ~ 144 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA
• NCBI: AAH00456
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged TSC22D1 is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to TSC22D1 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot analysis of TSC22D1 expression in transfected 293T cell line by TSC22D1 monoclonal antibody (M01), clone 1G7. Lane 1: TSC22D1 transfected lysate (15.7 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (41.58 KDa).