You have no items in your shopping cart.
TRPM8 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TRPM8 |
| Target | TRPM8 |
| Protein Sequence | Synthetic peptide located within the following region: YILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP |
| Molecular Weight | 128 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−TRPM8 Rabbit Polyclonal Antibody [orb1816947]
IF, IHC-Fr, IHC-P
Bovine, Equine, Mouse, Porcine, Rabbit, Sheep
Human, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlTRPM8 Rabbit Polyclonal Antibody [orb215282]
IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 30 μl, 100 μl, 50 μlTRPM8 rabbit pAb Antibody [orb774821]
ELISA, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. An isoform containing the peptide sequence is present at ~19 kDa.

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

Immunohistochemistry with Prostate tissue at an antibody concentration of 5 ug/mL using anti-TRPM8 antibody (orb329829).

WB Suggested Anti-TRPM8 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: ACHN cell lysate.
Documents Download
Request a Document
Protocol Information
TRPM8 Rabbit Polyclonal Antibody (orb329829)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review










