TRPA1 monoclonal antibody (M03), clone 6G8

• Catalog Number: orb2291796
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant TRPA1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 6G8
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: TRPA1 (NP_015628, 1033 a.a. ~ 1117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: IPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHL
• NCBI: NP_015628
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged TRPA1 is 1 ng/ml as a capture antibody.

Western Blot analysis of TRPA1 expression in transfected 293T cell line by TRPA1 monoclonal antibody (M03), clone 6G8. Lane 1: TRPA1 transfected lysate (Predicted MW: 123.09 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (35.09 KDa).