Trp63 Rabbit Polyclonal Antibody

SKU: orb324507

Description

Rabbit polyclonal antibody to p63

Research Area

Cell Biology, Epigenetics & Chromatin, Immunology & Inflammation, Molecular Biology, Protein Biochemistry, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: Trp63
• Protein Sequence: Synthetic peptide located within the following region: VTLETRDGQVLGRRCFEARICACPGRDRKADEDSIRKQQVSDSAKNGDGT
• Molecular Weight: 50kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti-Tumor protein 63 antibody, anti-Chronic ulcerative stomatitis protein antibody, anti-CUSP antibody, anti-Keratinocyte transcription factor KET antibody, anti-Transformation-related protein 63 antibody, anti-TP63 antibody, anti-p63 antibody, anti-Tumor protein p73-like antibody, anti-p73L antibody, anti-p40 antibody, anti-p51 antibody

WB Suggested Anti-Trp63 Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse heart.

Quick Database Links

Gene Symbol

Trp63

UniProt

Q9H3D4

RefSeq (Protein):NP_001108450.1