TRSPAP1 Rabbit Polyclonal Antibody

SKU: orb324907

Description

TRSPAP1 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of TRNAU1AP. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human TRSPAP1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRSPAP1
• Target: TRNAU1AP
• Protein Sequence: Synthetic peptide located within the following region: KPVEYSQMYSYSYNQYYQQYQNYYAQWGYDQNTGSYSYSYPQYGYTQSTM
• Molecular Weight: 32kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti FLJ20503 antibody, anti PRO1902 antibody, anti RP4-669K10.4 antibody, anti SECP43 antibody, anti TRSPAP1 antibody

Quick Database Links

Gene Symbol

TRNAU1AP

UniProt

Q9NX07

RefSeq (Protein):NP_060316