TRSPAP1 Rabbit Polyclonal Antibody

SKU: orb324907

Description

Rabbit polyclonal antibody to TRNAU1AP

Research Area

Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRSPAP1
• Target: TRNAU1AP
• Protein Sequence: Synthetic peptide located within the following region: KPVEYSQMYSYSYNQYYQQYQNYYAQWGYDQNTGSYSYSYPQYGYTQSTM
• Molecular Weight: 32kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti FLJ20503 antibody, anti PRO1902 antibody, anti RP4-669K10.4 antibody, anti SECP43 antibody, anti TRSPAP1 antibody

WB Suggested Anti-TRSPAP1 Antibody Titration: 1.25 ug/mL, Positive Control: Jurkat cell lysate, TRNAU1AP is supported by BioGPS gene expression data to be expressed in Jurkat.

Quick Database Links

Gene Symbol

TRNAU1AP

UniProt

Q9NX07

RefSeq (Protein):NP_060316