TRMT13 Rabbit Polyclonal Antibody

SKU: orb326188

Description

Rabbit polyclonal antibody to TRM13

Research Area

Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TRM13
• Target: TRMT13
• Protein Sequence: Synthetic peptide located within the following region: SHPALHDALNDPKNGDSATKHLKQQASILGNIENLKLLGPRRCFVEFGAG
• Molecular Weight: 52kDa
• Purification: Affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti TRMT13 antibody, anti CCDC76 antibody, anti antibody

Sample Type: U937 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.

Quick Database Links

Gene Symbol

TRMT13

UniProt

Q9NUP7

RefSeq (Protein):NP_061956