TRMT1 Rabbit Polyclonal Antibody

• Catalog Number: orb575151
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TRMT1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRMT1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 72kDa
• Target: TRMT1
• UniProt ID: Q9NXH9
• Protein Sequence: Synthetic peptide located within the following region: AMENGTGPYGEERPREVQETTVTEGAAKIAFPSANEVFYNPVQEFNRDLT
• NCBI: NP_060192
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: TRM1, MRT68
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-TRMT1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:2500, Positive Control: 293T cell lysate, There is BioGPS gene expression data showing that TRMT1 is expressed in HEK293T.