Trk A Antibody (Phospho-Tyr496)

• Catalog Number: orb2240632
• Category: Antibodies
• Description: Trk A Antibody (Phospho-Tyr496)
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ELISA, ICC, IF, WB
• Immunogen: The antiserum was produced against synthesized peptide derived from human Trk A around the phosphorylation site of Tyr496.
• Conjugation: Unconjugated
• MW: 87 kDa
• UniProt ID: P04629
• Protein Sequence: Synthetic peptide located within the following region: LGGSSLSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGA
• Storage: -20°C
• Alternative names: gp140trk;high affinity nerve growth factor recepto
• Note: For research use only
• Application notes: Application Info: IF: 1:100~1:500ELISA: 1:5000
• Expiration Date: 12 months from date of receipt.