You have no items in your shopping cart.
Cart summary
Item 1 of 1
TRIM9 monoclonal antibody (M01), clone 1F12
Catalog Number: orb2290704
| Catalog Number | orb2290704 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a partial recombinant TRIM9. |
| Clonality | Monoclonal |
| Species/Host | Mouse |
| Isotype | IgG2b Kappa |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Immunogen | TRIM9 (NP_055978.4, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPP |
| Tested applications | ELISA, WB |
| Clone Number | 1F12 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Note | For research use only |
| NCBI | NP_055978.4 |
Western Blot analysis of TRIM9 expression in transfected 293T cell line by TRIM9 monoclonal antibody (M01), clone 1F12. Lane 1: TRIM9 transfected lysate(61.3 KDa). Lane 2: Non-transfected lysate.
