Trim35 Rabbit Polyclonal Antibody

SKU: orb575088

Description

Rabbit polyclonal antibody to Trim35

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of MOUSE Trim35
• Target: Trim35
• Protein Sequence: Synthetic peptide located within the following region: AAGWLKVADDLTSVINHGYRVQVENPERFSSAPCLLGSQVFSKGSHSWEV
• Molecular Weight: 55kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

M, Hl, NC8, HLS5, Mair, AW046487, mKIAA1098, 0710005M05Rik, A430106H13Rik

Sample Tissue: Mouse Mouse Spleen, Antibody dilution: 1 ug/ml.

Sample Type: Mouse Kidney lysates, Antibody dilution: 1.0 ug/ml.

Quick Database Links

Gene Symbol

Trim35

UniProt

Q8C006

RefSeq (Protein):NP_084255