Trim35 Rabbit Polyclonal Antibody

• Catalog Number: orb575088
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Trim35
• Target: Trim35
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of MOUSE Trim35
• Protein Sequence: Synthetic peptide located within the following region: AAGWLKVADDLTSVINHGYRVQVENPERFSSAPCLLGSQVFSKGSHSWEV
• UniProt ID: Q8C006
• MW: 55kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: M, Hl, NC8, HLS5, Mair, AW046487, mKIAA1098, 07100
• Research Area: Cancer Biology, Cell Biology, Epigenetics & Chroma
• Note: For research use only
• NCBI: NP_084255

Sample Tissue: Mouse Mouse Spleen, Antibody dilution: 1 ug/ml.

Sample Type: Mouse Kidney lysates, Antibody dilution: 1.0 ug/ml.