TRHR Rabbit Polyclonal Antibody

• Catalog Number: orb592815
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TRHR
• Target: TRHR
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Predicted Reactivity: Canine, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRHR
• Protein Sequence: Synthetic peptide located within the following region: ISCGYKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFLNPIPSD
• UniProt ID: P34981
• MW: 45kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CHNG7, TRH-R
• Research Area: Pharmacology & Drug Discovery
• Note: For research use only
• NCBI: NP_003292
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml.