Cart summary

You have no items in your shopping cart.

TREX2 Peptide - C-terminal region

TREX2 Peptide - C-terminal region

Catalog Number: orb2001965

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb2001965
CategoryProteins
DescriptionTREX2 Peptide - C-terminal region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: ALRGLDRAHSHGTRARGRQGYSLGSLFHRYFRAEPSAAHSAEGDVHTLLL
UniProt IDQ9BQ50
MW25kDa
Application notesThis is a synthetic peptide designed for use in combination with TREX2 Rabbit Polyclonal Antibody (orb331491). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesTREX2,
NoteFor research use only
NCBINP_542432