Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

TRDMT1 Rabbit Polyclonal Antibody

SKU: orb330561

Description

TRDMT1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of TRDMT1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human TRDMT1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TRDMT1
TargetTRDMT1
Protein SequenceSynthetic peptide located within the following region: MILMSPPCQPFTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKYILLENV
Molecular Weight45 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti DNMT2 antibody, anti M.HsaIIP antibody, anti PuMet antibody, anti RNMT1 antibody, anti DMNT2 antibody, anti PUMET antibody, anti MHSAIIP antibody

Similar Products

  • Dnmt2 Antibody [orb1939099]

    IHC-P,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • TRDMT1 Rabbit Polyclonal Antibody [orb2951412]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • TRDMT1 Rabbit Polyclonal Antibody [orb626476]

    ELISA,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • Dnmt2 Rabbit Polyclonal Antibody (HRP) [orb478710]

    ELISA,  IHC-Fr,  IHC-P

    Bovine, Human, Mouse, Porcine, Rat, Sheep

    Rabbit

    Polyclonal

    HRP

    100 μl
  • Dnmt2 Rabbit Polyclonal Antibody (Cy5) [orb923087]

    ICC,  IF

    Bovine, Human, Mouse, Porcine, Rat, Sheep

    Rabbit

    Polyclonal

    Cy5

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

TRDMT1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

TRDMT1 Rabbit Polyclonal Antibody

WB Suggested Anti-TRDMT1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Muscle.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_004403

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

TRDMT1 Rabbit Polyclonal Antibody (orb330561)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry