TRBC2 Protein, Human, Recombinant (His)

• Catalog Number: orb1977746
• Category: Proteins
• Description: TRBC2 Protein, Human, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 16.2 kDa and the accession number is A0A5B9.
• Tag: C-6xHis
• Purity: 98.00%
• MW: 16.2 kDa (predicted)
• UniProt ID: A0A5B9
• Protein Sequence: DLKNVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
• Expression System: P. pastoris (Yeast)
• Biological Origin: Human
• Biological Activity: TRBC2 Protein, Human, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 16.2 kDa and the accession number is A0A5B9.
• Expression Region: 1-129 aa
• Storage: -20°C
• Note: For research use only
• Application notes: Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
• Expiration Date: 6 months from date of receipt.