PP2447 Rabbit Polyclonal Antibody

• Catalog Number: orb325029
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TRABD
• Target: TRABD
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PP2447
• Protein Sequence: Synthetic peptide located within the following region: MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMK
• UniProt ID: Q9H4I3
• MW: 41kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti RP3-402G11.12 antibody, anti LP6054 antibody,
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_079480
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-PP2447 Antibody Titration: 2.5 ug/mL, Positive Control: HepG2 cell lysate.