You have no items in your shopping cart.
Cart summary
TPSB2 Protein, Human, Recombinant (His & Myc)
Catalog Number: orb1977661
| Catalog Number | orb1977661 |
|---|---|
| Category | Proteins |
| Description | Tryptase is the major neutral protease present in mast cells and is secreted upon the coupled activation-degranulation response of this cell type. May play a role in innate immunity. TPSB2 Protein, Human, Recombinant (His & Myc) is expressed in yeast with C-6xHis-Myc tag. The predicted molecular weight is 31.2 kDa and the accession number is P20231. |
| Tag | C-6xHis-Myc |
| Purity | 98.00% |
| Protein Sequence | IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP |
| UniProt ID | P20231 |
| MW | 31.2 kDa (predicted) |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Human |
| Biological Activity | Tryptase is the major neutral protease present in mast cells and is secreted upon the coupled activation-degranulation response of this cell type. May play a role in innate immunity. TPSB2 Protein, Human, Recombinant (His & Myc) is expressed in yeast with C-6xHis-Myc tag. The predicted molecular weight is 31.2 kDa and the accession number is P20231. |
| Expression Region | 31-275 aa |
| Storage | -20°C |
| Note | For research use only |
