You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1145797 |
---|---|
Category | Antibodies |
Description | TPR Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human TPR (AAVLQQVLERTELNKLPKSVQNKLEKFLADQQ). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.25-0.5 μg/ml, Human Immunohistochemistry(Paraffin-embedded Section), 2-5 μg/ml, Human, Mouse, Rat Immunocytochemistry/Immunofluorescence, 5 μg/ml, Human Flow Cytometry, 1-3 μg/1x106 cells, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 267 kDa |
UniProt ID | P12270 |
Storage | At -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freezing and thawing. |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Expiration Date | 12 months from date of receipt. |
IHC analysis of TPR using anti-TPR antibody. TPR was detected in a paraffin-embedded section of human colorectal cancer tissue.
IHC analysis of TPR using anti-TPR antibody. TPR was detected in a paraffin-embedded section of mouse brain tissue.
IHC analysis of TPR using anti-TPR antibody. TPR was detected in a paraffin-embedded section of rat brain tissue.
IF analysis of TPR using anti-TPR antibody. TPR was detected in an immunocytochemical section of SiHa cells.
IF analysis of TPR using anti-TPR antibody. TPR was detected in an immunocytochemical section of CACO-2 cells.
Western blot analysis of TPR using anti-TPR antibody.
Flow Cytometry analysis of Jurkat cells using anti-TPR antibody(Blue line).Isotype control antibody(Green line) was rabbit IgG.Unlabelled sample(Red line) was also used as a control.
FC, ICC, IF, IHC, IHC-Fr, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, IF, IHC, WB | |
Canine, Rat | |
Human, Mouse | |
Goat | |
Polyclonal | |
Unconjugated |
Filter by Rating