Cart summary

You have no items in your shopping cart.

    TPR Antibody

    Catalog Number: orb1145797

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb1145797
    CategoryAntibodies
    DescriptionTPR Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, ICC, IF, IHC, WB
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence of human TPR (AAVLQQVLERTELNKLPKSVQNKLEKFLADQQ).
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Dilution rangeWestern blot, 0.25-0.5 μg/ml, Human Immunohistochemistry(Paraffin-embedded Section), 2-5 μg/ml, Human, Mouse, Rat Immunocytochemistry/Immunofluorescence, 5 μg/ml, Human Flow Cytometry, 1-3 μg/1x106 cells, Human
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW267 kDa
    UniProt IDP12270
    StorageAt -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freezing and thawing.
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Expiration Date12 months from date of receipt.
    TPR Antibody

    IHC analysis of TPR using anti-TPR antibody. TPR was detected in a paraffin-embedded section of human colorectal cancer tissue.

    TPR Antibody

    IHC analysis of TPR using anti-TPR antibody. TPR was detected in a paraffin-embedded section of mouse brain tissue.

    TPR Antibody

    IHC analysis of TPR using anti-TPR antibody. TPR was detected in a paraffin-embedded section of rat brain tissue.

    TPR Antibody

    IF analysis of TPR using anti-TPR antibody. TPR was detected in an immunocytochemical section of SiHa cells.

    TPR Antibody

    IF analysis of TPR using anti-TPR antibody. TPR was detected in an immunocytochemical section of CACO-2 cells.

    TPR Antibody

    Western blot analysis of TPR using anti-TPR antibody.

    TPR Antibody

    Flow Cytometry analysis of Jurkat cells using anti-TPR antibody(Blue line).Isotype control antibody(Green line) was rabbit IgG.Unlabelled sample(Red line) was also used as a control.

    • TPR Antibody [orb443133]

      FC,  ICC,  IF,  IHC,  IHC-Fr,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      10 μg, 100 μg
    • TTC11/FIS1 Antibody [orb654329]

      ELISA,  FC,  ICC,  IF,  IHC,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      10 μg, 100 μg
    • IFT88 Antibody [orb654334]

      ELISA,  FC,  ICC,  IF,  IHC,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      10 μg, 100 μg
    • IFT88 Antibody [orb1247371]

      ELISA,  FC,  IF,  IHC,  WB

      Canine, Rat

      Human, Mouse

      Goat

      Polyclonal

      Unconjugated

      0.1 mg
    • FIS1 antibody [orb45854]

      ELISA,  IF,  IHC

      Human

      Rabbit

      Polyclonal

      Unconjugated

      50 μg, 100 μg
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars