TPP1 monoclonal antibody (M01J), clone 3B1

• Catalog Number: orb2294337
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant TPP1.This product is belong to Cell Culture Grade Antibody (CX Grade).
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: TPP1 (AAH14863.1, 195 a.a. ~ 304 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: GLHLGVTPSVIRKRYNLTSQDVGSGTSNNSQACAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVVGQQGRGRAGIEASLDVQYLMSAGANISTWVYSSPGRHEGQEPF
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 3B1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH14863.1

Detection limit for recombinant GST tagged TPP1 is 1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to TPP1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml].

TPP1 monoclonal antibody (M01J), clone 3B1. Western Blot analysis of TPP1 expression in A-431.

Western Blot detection against Immunogen (37.73 KDa).