You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294338 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant TPP1. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | TPP1 (AAH14863, 195 a.a. ~ 304 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | GLHLGVTPSVIRKRYNLTSQDVGSGTSNNSQACAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVVGQQGRGRAGIEASLDVQYLMSAGANISTWVYSSPGRHEGQEPF |
Tested applications | ELISA, IHC-P, WB |
Clone Number | 3B1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH14863 |
Detection limit for recombinant GST tagged TPP1 is approximately 0.1 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to TPP1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml].
TPP1 monoclonal antibody (M01), clone 3B1 Western Blot analysis of TPP1 expression in A-431.
Western Blot detection against Immunogen (37.84 KDa).