TPM1 Rabbit Polyclonal Antibody

• Catalog Number: orb578066
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Tropomyosin
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Mouse
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TPM1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 28kDa
• Target: TPM1
• UniProt ID: Q7Z6L8
• Protein Sequence: Synthetic peptide located within the following region: LKEAETRAEFAERSVTKLEKSIDDLEDQLYQQLEQNRRLTNELKLALNED
• NCBI: NP_001018008
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CMH3, TMSA, CMD1Y, LVNC9, C15orf13, HEL-S-265, HTM
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-TPM1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human brain.