You have no items in your shopping cart.
Cart summary
TP53INP2 Peptide - C-terminal region
Catalog Number: orb2008631
| Catalog Number | orb2008631 |
|---|---|
| Category | Proteins |
| Description | TP53INP2 Peptide - C-terminal region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | RLQRARQRAERHALSAKAVQRQNRARESRPRRSKNQSSFIYQPCQRQFNY |
| UniProt ID | Q8IXH6 |
| MW | 24kDa |
| Tested applications | WB |
| Application notes | This is a synthetic peptide designed for use in combination with TP53INP2 Rabbit Polyclonal Antibody (orb584181). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | C20orf110, DKFZp434B2411, DKFZp434O0827, DOR, FLJ2 Read more... |
| Note | For research use only |
| NCBI | NP_067025 |
