You have no items in your shopping cart.
Cart summary
Item 1 of 1
TOR2A Rabbit Polyclonal Antibody
Catalog Number: orb581041
| Catalog Number | orb581041 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to TOR2A |
| Target | TOR2A |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TOR2A |
| Protein Sequence | Synthetic peptide located within the following region: GLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKS |
| UniProt ID | Q5JU69 |
| MW | 36kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | TORP1 |
| Note | For research use only |
| NCBI | NP_001078816 |
WB Suggested Anti-TOR2A Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate.
- Item 1 of 2
- Item 1 of 1
Salusin alpha Rabbit Polyclonal Antibody [orb526543]
WB
Human
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl - Item 1 of 1
