TOR1AIP2 Rabbit Polyclonal Antibody

SKU: orb326608

Description

TOR1AIP2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of TOR1AIP2. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N-terminal region of Human TOR1AIP2. This antibody reacts with Human samples and is predicted to react with Canine, Equine, Rat, Yeast. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Rat, Yeast

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TOR1AIP2
• Target: TOR1AIP2
• Protein Sequence: Synthetic peptide located within the following region: PDEANVGKHPKDKTEDENKQSFLDGGKGHHLPSENLGKEPLDPDPSHSPS
• Molecular Weight: 51kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti FLJ77012 antibody, anti IFRG15 antibody, anti LULL1 antibody, anti MGC120074 antibody, anti MGC120075 antibody, anti MGC120076 antibody, anti MGC120077 antibody, anti MGC126581 antibody, anti MGC138430 antibody, anti NET9 antibody, anti RP11-12M5.5 antibody

Quick Database Links

Gene Symbol

TOR1AIP2

UniProt

Q8NFQ8

RefSeq (Protein):NP_659471