TOR1AIP2 Rabbit Polyclonal Antibody

SKU: orb326608

Description

Rabbit polyclonal antibody to TOR1AIP2

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Rat, Yeast

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TOR1AIP2
• Target: TOR1AIP2
• Protein Sequence: Synthetic peptide located within the following region: PDEANVGKHPKDKTEDENKQSFLDGGKGHHLPSENLGKEPLDPDPSHSPS
• Molecular Weight: 51kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti FLJ77012 antibody, anti IFRG15 antibody, anti LULL1 antibody, anti MGC120074 antibody, anti MGC120075 antibody, anti MGC120076 antibody, anti MGC120077 antibody, anti MGC126581 antibody, anti MGC138430 antibody, anti NET9 antibody, anti RP11-12M5.5 antibody

WB Suggested Anti-TOR1AIP2 Antibody, Titration: 1.0 ug/mL, Positive Control: Fetal Lung.

Quick Database Links

Gene Symbol

TOR1AIP2

UniProt

Q8NFQ8

RefSeq (Protein):NP_659471