TOP2A Rabbit Polyclonal Antibody

SKU: orb592711

Description

Rabbit polyclonal antibody to TOP2A

Research Area

Epigenetics & Chromatin, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TOP2A
• Target: TOP2A
• Protein Sequence: Synthetic peptide located within the following region: VSKAVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKPIKYLEESDEDDLF
• Molecular Weight: 174kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

TOP2, TP2A, TOPIIA, TOP2alpha

Rabbit Anti-TOP2A antibody, Paraffin Embedded Tissue: Human Liver cell Cellular Data: hepatocyte of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-TOP2A Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate. TOP2A is supported by BioGPS gene expression data to be expressed in HepG2.

Quick Database Links

Gene Symbol

TOP2A

UniProt

P11388

RefSeq (Protein):NP_001058