TMPRSS3 antibody

Catalog Number: orb330937

Catalog Number	orb330937
Category	Antibodies
Description	Rabbit polyclonal antibody to TMPRSS3
Species/Host	Rabbit
Clonality	Polyclonal
Tested applications	WB
Predicted Reactivity	Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
Reactivity	Canine, Equine, Guinea pig, Human, Mouse, Rat
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human TMPRSS3
Concentration	0.5 mg/ml
Form/Appearance	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
MW	37kDa
Target	TMPRSS3
UniProt ID	P57727
Protein Sequence	Synthetic peptide located within the following region: MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFP
NCBI	NP_115781
Storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Alternative names	anti DFNB10 antibody, anti DFNB8 antibody, anti EC Read more...
Note	For research use only
Expiration Date	12 months from date of receipt.

Western blot analysis of mouse Brain lysate tissue using TMPRSS3 antibody

Western blot analysis of Jurkat cell lysate tissue using TMPRSS3 antibody