TMEM63B Rabbit Polyclonal Antibody

• Catalog Number: orb324909
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TMEM63B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMEM63B
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 95 kDa
• Target: TMEM63B
• UniProt ID: Q5T3F8
• Protein Sequence: Synthetic peptide located within the following region: VRGCEQVEAIEYYTKLEQKLKEDYKREKEKVNEKPLGMAFVTFHNETITA
• NCBI: NP_060896
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti C6orf110 antibody, anti DKFZp686N2275 antibod
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Peptide is included in isoforms of 95 kDa, 81 and 56 kDa. Protein may be phosphorylated.

WB Suggested Anti-TMEM63B Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: 293T cell lysate.