TMEM63B Rabbit Polyclonal Antibody

SKU: orb324909

Description

Rabbit polyclonal antibody to TMEM63B

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMEM63B
• Target: TMEM63B
• Protein Sequence: Synthetic peptide located within the following region: VRGCEQVEAIEYYTKLEQKLKEDYKREKEKVNEKPLGMAFVTFHNETITA
• Molecular Weight: 95 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti C6orf110 antibody, anti DKFZp686N2275 antibody, anti RP3-421H19.2 antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Peptide is included in isoforms of 95 kDa, 81 and 56 kDa. Protein may be phosphorylated.

WB Suggested Anti-TMEM63B Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: 293T cell lysate.

Quick Database Links

Gene Symbol

TMEM63B

UniProt

Q5T3F8

RefSeq (Protein):NP_060896