TMEM222 Rabbit Polyclonal Antibody

SKU: orb326346

Description

Rabbit polyclonal antibody to TMEM222

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: TMEM222
• Protein Sequence: Synthetic peptide located within the following region: WKLDPAQVYASGPNAWDTAVHDASEEYKHRMHNLCCDNCHSHVALALNLM
• Molecular Weight: 23kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti C1orf160 antibody, anti DKFZp564D0478 antibody, anti MGC111002 antibody, anti RP11-4K3__A.4 antibody

WB Suggested Anti-TMEM222 Antibody, Titration: 1.0 ug/mL, Positive Control: Fetal Lung.

Quick Database Links

Gene Symbol

TMEM222

UniProt

Q9H0R3

RefSeq (Protein):NP_115501