Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

TMEM221 Rabbit Polyclonal Antibody

SKU: orb587858

Description

TMEM221 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of TMEM221. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMEM221. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Porcine. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Porcine

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human TMEM221
TargetTMEM221
Protein SequenceSynthetic peptide located within the following region: RAARRGLHELSPPSFEDDLARPAEVSKASPRAQPQQGIHRRTPYSTCPEP
Molecular Weight32kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • TMEM221 Rabbit Polyclonal Antibody (HRP) [orb2084426]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Porcine

    Rabbit

    Polyclonal

    HRP

    100 μl
  • TMEM221 Rabbit Polyclonal Antibody (FITC) [orb2084427]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Porcine

    Rabbit

    Polyclonal

    FITC

    100 μl
  • TMEM221 Rabbit Polyclonal Antibody (Biotin) [orb2084428]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Porcine

    Rabbit

    Polyclonal

    Biotin

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

TMEM221 Rabbit Polyclonal Antibody

Sample Tissue: Human HCT15 Whole Cell, Antibody Dilution: 1 ug/ml.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

TMEM221 Rabbit Polyclonal Antibody (orb587858)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry