TMEM173 Rabbit Polyclonal Antibody

• Catalog Number: orb580259
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TMEM173
• Target: TMEM173
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Porcine
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMEM173
• Protein Sequence: Synthetic peptide located within the following region: DPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPL
• UniProt ID: Q86WV6
• MW: 42kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ERIS, MITA, MPYS, SAVI, NET23, STING, hMITA, hSTIN
• Note: For research use only
• NCBI: NP_938023

Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.

WB Suggested Anti-TMEM173 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Hela cell lysate.