You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb388577 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody to TMEM16A |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | DG1/447 + DOG-1.1 |
Tested applications | IHC-P |
Reactivity | Human |
Isotype | Mouse / IgG1, kappa + Mouse / IgG1, kappa |
Immunogen | Recombinant human DOG-1 protein (DG1/447) + A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1). |
Concentration | Purified Ab with BSA and Azide at 200ug/ml |
Dilution range | FACS: 0.5-1 μg/million cells, IF/ICC: 0.5-1 μg/ml, IHC-P: 0.25-0.5 μg/ml |
Conjugation | Unconjugated |
MW | ~114kDa |
Target | TMEM16A |
Entrez | 55107 |
UniProt ID | Q5XX6 |
Storage | Antibody with azide - store at 2 to 8°C. Antibody without azide - store at -20 to -80°C. Antibody is stable for 24 months. Non-hazardous. No MSDS required. |
Buffer/Preservatives | 200ug/ml of Ab Purified from Bioreactor Concentrate by Protein A/G. Prepared in 10mM PBS with 0.05% rAlbumin & 0.05% azide. Also available WITHOUT rAlbumin & azide at 1.0mg/ml. |
Alternative names | Anoctamin 1; Calcium Activated Chloride Channel; D Read more... |
Note | For research use only |
Application notes | DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker) |
Expiration Date | 12 months from date of receipt. |
Immunohistochemical staining of human GIST tissue using TMEM16A antibody
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating