TMEM16A/ANO1 Antibody

• Catalog Number: orb443147
• Category: Antibodies
• Description: TMEM16A/ANO1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, IHC, WB
• Reactivity: Human
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human TMEM16A (QQIHKEK VLMVELFMREEQDKQQLLETWMEKERQKDE).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 130 kDa
• UniProt ID: Q5XXA6
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Anoctamin-1; Discovered on gastrointestinal stroma
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of A431 cells using anti-TMEM16A antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of TMEM16A using anti-TMEM16A antibody.Lane 1:human HeLa Cell;2:human HepG2 Cell;3:human A549 Cell;4:human PANC-1 Cell;5:human SK-OV-3 Cell;6:human SGC-7901 Cell;7:human COLO-320 Cell.

IHC analysis of TMEM16A using anti-TMEM16A antibody.TMEM16A was detected in paraffin-embedded section of human oesophagus squama cancer tissues.