TMEM141 Rabbit Polyclonal Antibody

SKU: orb326367

Description

TMEM141 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting TMEM141. It is suitable for WB and is reactive with human samples. Predicted reactivity includes Bovine, Mouse. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Mouse

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: TMEM141
• Protein Sequence: Synthetic peptide located within the following region: PLQWSLLVAVVAGSVVSYGVTRVESEKCNNLWLFLETGQLPKDRSTDQRS
• Molecular Weight: 12kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti MGC14141 antibody, anti RP11-216L13.7 antibody

Quick Database Links

Gene Symbol

TMEM141

UniProt

Q96I45

RefSeq (Protein):NP_116317