TMEM104 Rabbit Polyclonal Antibody

SKU: orb325334

Description

TMEM104 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of TMEM104. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human TMEM104. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMEM104
• Target: TMEM104
• Protein Sequence: Synthetic peptide located within the following region: GDLAIYAAAVPFSLMQVTCSATGNDSCGVEADTKYNDTDRCWGPLRRVDA
• Molecular Weight: 35kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti FLJ00021 antibody, anti FLJ20255 antibody

Quick Database Links

Gene Symbol

TMEM104

UniProt

Q8NE00

RefSeq:EAW89200