You have no items in your shopping cart.
Cart summary
Item 1 of 1
TIRAP3 Rabbit Polyclonal Antibody
Catalog Number: orb326690
| Catalog Number | orb326690 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to TMED7 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human TIRAP3 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 44kDa |
| Target | TMED7-TICAM2 |
| UniProt ID | Q6JUT2 |
| Protein Sequence | Synthetic peptide located within the following region: FRLREAQGRSRAEDLNTRVAYWHSVDTSPGYHESDSKKSEDLSLCNVAEH |
| NCBI | NP_001157940 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | anti TAG antibody, anti TIRAP3 antibody Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Sample Type: RPMI-8226 whole cell lysates, Antibody Dilution: 1.0 ug/mL.
- Item 1 of 1
- Item 1 of 2
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
