TMED3 Rabbit Polyclonal Antibody

• Catalog Number: orb330495
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TMED3
• Target: TMED3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TMED3
• Protein Sequence: Synthetic peptide located within the following region: DRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPISRAVHS
• UniProt ID: Q9Y3Q3
• MW: 25kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti C15orf22 antibody, anti MGC133022 antibody, a
• Research Area: Cell Biology, Signal Transduction
• Note: For research use only
• NCBI: NP_031390

WB Suggested Anti-TMED3 Antibody Titration: 2.5 ug/mL, Positive Control: HepG2 cell lysate.