Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Page Not Found
Cart summary

You have no items in your shopping cart.

TLR4 Rabbit Polyclonal Antibody

SKU: orb584238

Description

TLR4 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of TLR4. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C terminal region of human TLR4. This antibody reacts with Human samples and is predicted to react with Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Immunology & Inflammation

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityRat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human TLR4
TargetTLR4
Protein SequenceSynthetic peptide located within the following region: QQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTG
Molecular Weight93kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

TOLL, CD284, TLR-4, ARMD10

Similar Products

  • TLR4 Rabbit Polyclonal Antibody [orb11489]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Mouse, Porcine, Sheep

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • TLR4 Rabbit Polyclonal Antibody [orb371961]

    ICC,  IF,  IHC-P

    Human, Mouse, Porcine, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 200 μg
  • TLR4 Antibody [orb67563]

    FACS,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • TLR4 Antibody (APC) [orb152201]

    FACS,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    APC

    100 μg
  • TLR4 Antibody (Biotin) [orb152202]

    FACS,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Biotin

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

TLR4 Rabbit Polyclonal Antibody

Lanes: Lane 1: Untreated human U251 cell lysate, Lane 2: IL-1beta treated human U251 cell lysate, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:500, Gene Name: TLR4.

TLR4 Rabbit Polyclonal Antibody

WB Suggested Anti-TLR4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: A549 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_612564

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

TLR4 Rabbit Polyclonal Antibody (orb584238)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry