TLL1 Rabbit Polyclonal Antibody

SKU: orb586022

Description

Rabbit polyclonal antibody to TLL1

Research Area

Cardiovascular Research, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TLL1
• Target: TLL1
• Protein Sequence: Synthetic peptide located within the following region: DASVQRKGFQATHSTECGGRLKAESKPRDLYSHAQFGDNNYPGQVDCEWL
• Molecular Weight: 115kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

TLL, ASD6

Positive control (+): Human Lung (LU), Negative control (-): HepG2 cell lysate (HG), Antibody concentration: 1 ug/ml.

WB Suggested Anti-TLL1 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Heart.

Quick Database Links

Gene Symbol

TLL1

UniProt

O43897

RefSeq (Protein):NP_036596