TLL1 Rabbit Polyclonal Antibody

• Catalog Number: orb586022
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TLL1
• Target: TLL1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TLL1
• Protein Sequence: Synthetic peptide located within the following region: DASVQRKGFQATHSTECGGRLKAESKPRDLYSHAQFGDNNYPGQVDCEWL
• UniProt ID: O43897
• MW: 115kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: TLL, ASD6
• Research Area: Cardiovascular Research, Stem Cell & Developmental
• Note: For research use only
• NCBI: NP_036596

Positive control (+): Human Lung (LU), Negative control (-): HepG2 cell lysate (HG), Antibody concentration: 1 ug/ml.

WB Suggested Anti-TLL1 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Heart.