TIMP3 Antibody

• Catalog Number: orb19301
• Category: Antibodies
• Description: TIMP3 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ELISA, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human TIMP3 (107-141aa RVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHL), different from the related mouse and rat sequences by two amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: ELISA , 0.1-0.5μg/ml, Human, -Western blot, 0.1-0.5μg/ml, Mouse, Rat, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 24145 MW
• UniProt ID: P35625
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Metalloproteinase inhibitor 3;Protein MIG-5;Tissue
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of TIMP3 using anti-TIMP3 antibody.Lane 1:rat kidney tissue;2:NIH3T3 cell.