Timp2 Rabbit Polyclonal Antibody

• Catalog Number: orb578341
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Timp2
• Target: Timp2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Sheep, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: ECLWMDWVTEKSINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
• UniProt ID: Q8BSJ3
• MW: 24kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: TIMP, Timp-2, D11Bwg1104e
• Research Area: Cancer Biology, Cell Biology, Epigenetics & Chroma
• Note: For research use only
• NCBI: NP_035724

Sample Tissue: Rodent Mouse Testis, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-Timp2 Antibody, Titration: 0.1 ug/ml, Positive Control: Mouse Thymus.