Thrombopoietin/THPO Antibody

• Catalog Number: orb527009
• Category: Antibodies
• Description: Thrombopoietin/THPO Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human Thrombopoietin/THPO (DFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQL).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 38 kDa
• UniProt ID: P40225
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Thrombopoietin; C-mpl ligand; ML; Megakaryocyte co
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of Thrombopoietin using anti-Thrombopoietin antibody.Lane 1:human HepG2 Cell;2:human Caco-2 Cell;3:rat liver Tissue;4:mouse liver Tissue.