Thg1l Rabbit Polyclonal Antibody

SKU: orb325369

Description

Rabbit polyclonal antibody to Thg1l

Research Area

Epigenetics & Chromatin, Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Target: Thg1l
• Protein Sequence: Synthetic peptide located within the following region: RNFHRFAEEHNFAKPNDSRALHLMTKCAQTVMEELEDIVIAYGQSDEYSF
• Molecular Weight: 35kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti 1700121M19Rik antibody, anti 5730409G07Rik antibody, anti AA387658 antibody, anti MGC107321 antibody, anti RP23-298M7.6 antibody

WB Suggested Anti-Thg1l Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Spleen.

Quick Database Links

Gene Symbol

Thg1l

UniProt

Q9CY52

RefSeq (Protein):NP_001074438