TGIF2LY Rabbit Polyclonal Antibody

• Catalog Number: orb575822
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TGIF2LY
• Target: TGIF2LY
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Yeast
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TGIF2LY
• Protein Sequence: Synthetic peptide located within the following region: NWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEASVPAKSGP
• UniProt ID: Q8IUE0
• MW: 21kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: TGIFLY
• Research Area: Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_631960

WB Suggested Anti-TGIF2LY Antibody, Titration: 1.25 ug/ml, Positive Control: HepG2 Whole Cell.