TGFB2 Rabbit Polyclonal Antibody

SKU: orb579467

Description

TGFB2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of TGFB2. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human TGFB2. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cancer Biology, Cell Biology, Neuroscience, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TGFB2
• Target: TGFB2
• Protein Sequence: Synthetic peptide located within the following region: NLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKT
• Molecular Weight: 46kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

LDS4, G-TSF, TGF-beta2

Quick Database Links

Gene Symbol

TGFB2

UniProt

P61812

RefSeq (Protein):NP_003229