TFRC monoclonal antibody (M01), clone 1E6

• Catalog Number: orb2292062
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant TFRC.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2b Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: TFRC (AAH01188, 68 a.a. ~ 168 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: YGTIAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALY
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 1E6
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH01188

Detection limit for recombinant GST tagged TFRC is approximately 0.3 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to TFRC on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1 ug/ml]

TFRC monoclonal antibody (M01), clone 1E6 Western Blot analysis of TFRC expression in Hela S3 NE.

Western Blot detection against Immunogen (36.74 KDa).