You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292070 |
---|---|
Category | Antibodies |
Description | Mouse polyclonal antibody raised against a full-length human TFAM protein. |
Clonality | Polyclonal |
Species/Host | Mouse |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | TFAM (NP_003192.1, 1 a.a. ~ 246 a.a) full-length human protein. |
Protein Sequence | MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC |
Tested applications | IF, IHC-P, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_003192.1 |
Immunofluorescence of purified MaxPab antibody to TFAM on HeLa cell. [antibody concentration 10 ug/ml]
Immunoperoxidase of purified MaxPab antibody to TFAM on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
TFAM MaxPab polyclonal antibody. Western Blot analysis of TFAM expression in human kidney.
Western Blot analysis of TFAM expression in transfected 293T cell line by TFAM MaxPab polyclonal antibody. Lane 1: TFAM transfected lysate (27.06 KDa). Lane 2: Non-transfected lysate.