You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
TFAM MaxPab rabbit polyclonal antibody (D01)
Catalog Number: orb2292069
| Catalog Number | orb2292069 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody raised against a full-length human TFAM protein. |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | IP, WB |
| Reactivity | Human, Mouse |
| Immunogen | TFAM (NP_003192.1, 1 a.a. ~ 246 a.a) full-length human protein. |
| Conjugation | Unconjugated |
| Protein Sequence | MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC |
| NCBI | NP_003192.1 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | No additive |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Immunoprecipitation of TFAM transfected lysate using anti-TFAM MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with TFAM purified MaxPab mouse polyclonal antibody (B01P) (orb2292070).
TFAM MaxPab rabbit polyclonal antibody. Western Blot analysis of TFAM expression in mouse liver.
Western Blot analysis of TFAM expression in transfected 293T cell line by TFAM MaxPab polyclonal antibody. Lane 1: TFAM transfected lysate (29.10 KDa). Lane 2: Non-transfected lysate.
