You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292069 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human TFAM protein. |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Buffer/Preservatives | No additive |
Immunogen | TFAM (NP_003192.1, 1 a.a. ~ 246 a.a) full-length human protein. |
Protein Sequence | MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC |
Tested applications | IP, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_003192.1 |
Immunoprecipitation of TFAM transfected lysate using anti-TFAM MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with TFAM purified MaxPab mouse polyclonal antibody (B01P) (orb2292070).
TFAM MaxPab rabbit polyclonal antibody. Western Blot analysis of TFAM expression in mouse liver.
Western Blot analysis of TFAM expression in transfected 293T cell line by TFAM MaxPab polyclonal antibody. Lane 1: TFAM transfected lysate (29.10 KDa). Lane 2: Non-transfected lysate.