Tfam Rabbit Polyclonal Antibody

SKU: orb584094

Description

Rabbit polyclonal antibody to Tfam

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Mouse

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Target: Tfam
• Protein Sequence: Synthetic peptide located within the following region: LGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYI
• Molecular Weight: 28kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Hmgt, mtTF, tsHM, Hmgts, mtTFA, tsHMG, AI661103

Immunohistochemistry with Placenta tissue at an antibody concentration of 5 ug/ml using anti-Tfam antibody (orb584094).

WB Suggested Anti-Tfam Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Mouse Muscle.

Quick Database Links

Gene Symbol

Tfam

UniProt

P40630

RefSeq (Protein):NP_033386