TFAM Rabbit Polyclonal Antibody

• Catalog Number: orb576168
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TFAM
• Target: TFAM
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse TFAM
• Protein Sequence: Synthetic peptide located within the following region: SESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDRIRYDNEMK
• UniProt ID: P40630
• MW: 27kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Hmgt, mtTF, tsHM, Hmgts, mtTFA, tsHMG, AI661103
• Research Area: Cardiovascular Research, Epigenetics & Chromatin,
• Note: For research use only
• NCBI: NP_033386

Sample Tissue: Human Fetal Kidney, Antibody Dilution: 1.0 ug/ml.

WB Suggested Anti-TFAM Antibody Titration: 2 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Liver.